Factors @ Stark Lab

Gene Name	Type	Activity (log2) in S2 cells (avg/min/max)	Cluster	Data available
Gene Name	Type	Activity (log2) in S2 cells (avg/min/max)	Cluster	S2	Kc167	BG3	OSC	HeLa
CG4210 (FBgn0038302)	cofactor	(-0.19/-2.57/0.74)	4	◼	◻	◻	◻	◻

Factor activity

Celltype:
S2

Additional information

CG4210 [FlyBase] | CG4210 [FlyMine] | CG4210 [BDGP]

H. sapiens orthologues¹

SAT2 (HGNC:23160, ENSG00000141504), SAT1 (HGNC:10540, ENSG00000130066)

Functionally similar transcription factors and cofactors

Similarity:

Euclidean distance

TF	Euclidean distance (rank)
CG17361	1.606 (1)
Crg-1	1.679 (2)
CG11317	1.794 (3)
CG15715	1.875 (4)
RunxB	1.894 (5)

All TFs

Cofactor	Euclidean distance (rank)
MED7	0.859 (1)
Taf12	1.016 (2)
CG31730	1.034 (3)
san	1.048 (4)
Taf10	1.065 (5)

All cofactors

Pearson correlation

TF	Pearson correlation (rank)
RunxB	0.924 (1)
mor	0.914 (2)
Crg-1	0.891 (3)
CG17361	0.888 (4)
ATbp	0.868 (5)

All TFs.

Cofactor	Pearson correlation (rank)
MED7	0.981 (1)
RpA-70	0.980 (2)
Taf12	0.978 (3)
TfIIFalpha	0.974 (4)
CG14260	0.970 (5)

All cofactors.

CDS DNA Sequence²

ATGTCGAAATCCGGAGAGTTTACATTCCGGCGTGCTCTAGCTGAAGATATTAAAGATGTGCTCTCCATGATTCAAGTTGAGTTTTATAAGATTCCTATTTTAATACCAATT

CDS AA Sequence²

MSKSGEFTFRRALAEDIKDVLSMIQVEFYKIPILIPI

¹ H. sapiens orthologs were obtained from InParanoid8, in particular D.melanogaster-H.sapiens.orthoXML.
² Genomic sequences of the transcription factors were obtained from the dm3/BDGP Release 5 genome assembly. In the case of cofactors, the genomic sequences stand for our results obtained by deep sequencing.